Primary Antibodies

View as table Download

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) aFGF mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2), HRP conjugated

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1

aFGF (FGF1) mouse monoclonal antibody, clone OTI4D2 (formerly 4D2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-Fgf1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Fgf1 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ

FGF1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human FGF1