Primary Antibodies

Jump to Filters
View as table Download
AP3S1 Rabbit Polyclonal Antibody
TA319631

USD 570.00

5 Days

Rabbit Polyclonal AP3S1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AP3S1 antibody was raised against a 19 amino acid synthetic peptide near the center of human AP3S1.
AP3S1 (N-term) Rabbit Polyclonal Antibody
AP50203PU-N

USD 580.00

2 Weeks

AP3S1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 2-31 amino acids from the N-terminal region of human AP3S1
AP3S1 Rabbit Polyclonal Antibody
TA340005

USD 539.00

5 Days

Rabbit Polyclonal Anti-AP3S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP3S1 antibody: synthetic peptide directed towards the N terminal of human AP3S1. Synthetic peptide located within the following region: IKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLE
AP3S1 Rabbit Polyclonal Antibody
TA340006

USD 539.00

5 Days

Rabbit Polyclonal Anti-AP3S1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AP3S1 antibody: synthetic peptide directed towards the C terminal of human AP3S1. Synthetic peptide located within the following region: IDAQNKLEKSEAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLP