Primary Antibodies

View as table Download

Claudin 15 (CLDN15) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 135~165 amino acids from the Central region of human CLDN15

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15. Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV

Rabbit Polyclonal Anti-CLDN15 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the middle region of human CLDN15. Synthetic peptide located within the following region: LSGYIQACRALMITAILLGFLGLLLGIAGLRCTNIGGLELSRKAKLAATA