Claudin 15 (CLDN15) Rabbit Polyclonal Antibody

CAT#: TA334207

Rabbit Polyclonal Anti-CLDN15 Antibody

Product Images

WB Suggested Anti-CLDN15 Antibody Titration: 5.0 ug/ml; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN15 antibody: synthetic peptide directed towards the C terminal of human CLDN15. Synthetic peptide located within the following region: LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 24 kDa
• Gene Name: claudin 15
• Database Link:
  NP_055158
  Entrez Gene 24146 Human
  UniProt ID P56746
• Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet.
• Synonyms: FLJ42715; MGC19536
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction