Primary Antibodies

View as table Download

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2), Biotinylated

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Carrier-free (BSA/glycerol-free) RASSF5 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1H2 (formerly 1H2)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-RASSF5 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Rassf5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rassf5. Synthetic peptide located within the following region: SFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIHQLQKKYNKFRQK

RASSF5 (NORE1) mouse monoclonal antibody, clone OTI1A11 (formerly 1A11)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".