Goat Polyclonal Antibody against Flotillin 1
| Applications | IHC, WB |
| Reactivities | Human (Expected from sequence similarity: Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SISQVNHKPLRTA, from the C Terminus of the protein sequence according to NP_005794. |
Rabbit Polyclonal Anti-FLOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the C-terminal region of Human FLOT1. Synthetic peptide located within the following region: QQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYKLER |
Rabbit Polyclonal Anti-FLOT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FLOT1 antibody is: synthetic peptide directed towards the middle region of Human FLOT1. Synthetic peptide located within the following region: IREAKAKQEKVSAQYLSEIEMAKAQRDYELKKAAYDIEVNTRRAQADLAY |
FLOT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human FLOT1 |
Germany
Japan
United Kingdom
China
