Primary Antibodies

Jump to Filters
View as table Download
B3GALT2 Rabbit Polyclonal Antibody
TA314797

USD 380.00

4 Weeks

Rabbit polyclonal anti-B3GALT2 antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human B3GALT2.
B3GALT2 Rabbit Polyclonal Antibody
TA338206

USD 539.00

5 Days

Rabbit Polyclonal Anti-B3galt2 Antibody

Applications IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-B3galt2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RVDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNK