Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-IDH3B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH3B

Goat Polyclonal Anti-IDH3B (aa33-46) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-IDH3B (aa33-46) Antibody: Peptide with sequence C-HAASRSQAEDVRVE, from the internal region (near N Terminus) of the protein sequence according to NP_008830.2; NP_777280.1.

Rabbit Polyclonal Anti-IDH3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: SEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRK

Rabbit Polyclonal Anti-IDH3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IDH3B antibody is: synthetic peptide directed towards the N-terminal region of Human IDH3B. Synthetic peptide located within the following region: RIAKFAFDYATKKGRGKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKF

Rabbit Polyclonal Anti-IDH3B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH3B antibody is: synthetic peptide directed towards the C-terminal region of Human IDH3B. Synthetic peptide located within the following region: YMTRHNNLDLVIIREQTEGEYSSLEHEVRPQKLGEGKDEDGREVELLVSL

IDH3B Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human IDH3B