Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal beta-1,3-Glucuronyltransferase 1/B3GAT1/CD57 Antibody
| Applications | ICC/IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal portion of the human CD57 protein (between residues 1-50) [UniProt Q9P2W7] |
Rabbit polyclonal CSGALNACT2 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT2. |
Rabbit polyclonal CSGALNACT1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CSGALNACT1. |
B3GAT2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 130-158 amino acids from the Central region of human B3GAT2 |
Rabbit Polyclonal Anti-Chst11 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Chst11 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Chst11. Synthetic peptide located within the following region: RMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYN |
Active filters
Reactivities
- Mouse
Pathways
- Chondroitin sulfate biosynthesis