Primary Antibodies

View as table Download

Goat Polyclonal Antibody against thyroid peroxidase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1.

Rabbit Polyclonal Anti-TPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS

TPO Antibody - C-terminal region (ARP44312_P050)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human TPO

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35

Applications ELISA
Reactivities Human
Conjugation Unconjugated

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO28

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO34

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated