Primary Antibodies

Jump to Filters
View as table Download
Glutathione Peroxidase 3 (GPX3) (102-114) Goat Polyclonal Antibody
AP22523PU-N

USD 555.00

2 Weeks

Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Equine, Monkey, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide from internal region of human GPX3
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA309678

USD 550.00

5 Days

Rabbit Polyclonal Glutathione Peroxidase 3 Antibody

Applications ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli.
Glutathione Peroxidase 3 (GPX3) Rabbit Polyclonal Antibody
TA346086

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI