Primary Antibodies

Jump to Filters
View as table Download
TARS2 Rabbit Polyclonal Antibody
TA343261

USD 539.00

5 Days

Rabbit Polyclonal Anti-TARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TARS2 antibody is: synthetic peptide directed towards the C-terminal region of Human TARS2. Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY
TARS2 Rabbit Polyclonal Antibody
TA362420

USD 539.00

5 Days

TARS2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human TARS2