Rabbit polyclonal antibody to FPGT (fucose-1-phosphate guanylyltransferase)
| Applications | IHC, WB |
| Reactivities | Human (Predicted: Dog, Monkey, Pig, Rabbit, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 453 of FPGT (Uniprot ID#O14772) |
Rabbit Polyclonal Anti-FPGT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FPGT antibody is: synthetic peptide directed towards the C-terminal region of Human FPGT. Synthetic peptide located within the following region: TSLNVVVLNNSKFYHIGTTEEYLFYFTSDNSLKSELGLQSITFSIFPDIP |
FPGT Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
