Primary Antibodies

Jump to Filters
View as table Download
HIF 2 alpha (EPAS1) (N-term) Rabbit Polyclonal Antibody
AP51440PU-N

USD 580.00

2 Weeks

HIF 2 alpha (EPAS1) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 127-154 amino acids from the N-terminal region of Human HIF2A
HIF 2 alpha (EPAS1) Rabbit Polyclonal Antibody
TA330214

USD 539.00

5 Days

Rabbit Polyclonal Anti-EPAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EPAS1 antibody: synthetic peptide directed towards the middle region of human EPAS1. Synthetic peptide located within the following region: ESLFKPHLMAMNSIFDSSGKGAVSEKSNFLFTKLKEEPEELAQLAPTPGD
HIF 2 alpha (EPAS1) Mouse Monoclonal Antibody [Clone ID: OTI2G5]
TA801746S

USD 200.00

2 Days

EPAS1 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".