Primary Antibodies

Jump to Filters
View as table Download
PECR Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1C9]
TA501809BM

USD 509.00

2 Weeks

Anti-PECR mouse monoclonal antibody, clone OTI1C9 (formerly 1C9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP
ELOVL5 Rabbit Polyclonal Antibody
TA315700

USD 380.00

2 Weeks

Rabbit polyclonal anti-ELOVL5 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ELOVL5.
PECR Mouse Monoclonal Antibody [Clone ID: OTI1E4]
TA501985

USD 447.00

In Stock

PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
HADHA Mouse Monoclonal Antibody [Clone ID: OTI7B3]
TA812134

USD 447.00

In Stock

HADHA mouse monoclonal antibody,clone OTI7B3

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
PECR Mouse Monoclonal Antibody [Clone ID: OTI1E4]
CF501985

USD 600.00

4 Weeks

Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1E4 (formerly 1E4)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
HADHA Mouse Monoclonal Antibody [Clone ID: OTI7B3]
CF812134

USD 564.00

4 Weeks

Carrier-free (BSA/glycerol-free) HADHA mouse monoclonal antibody,clone OTI7B3

Applications WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
PECR Mouse Monoclonal Antibody [Clone ID: OTI1E12]
TA501964

USD 447.00

In Stock

PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
PECR Mouse Monoclonal Antibody [Clone ID: OTI1E12]
CF501964

USD 600.00

4 Weeks

Carrier-free (BSA/glycerol-free) PECR mouse monoclonal antibody, clone OTI1E12 (formerly 1E12)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
ACAA1 Mouse Monoclonal Antibody [Clone ID: OTI4F1]
TA811054S

USD 200.00

2 Days

ACAA1 mouse monoclonal antibody,clone OTI4F1

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ELOVL5 Rabbit Polyclonal Antibody
TA338477

USD 539.00

5 Days

Rabbit Polyclonal Anti-ELOVL5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ELOVL5 antibody: synthetic peptide directed towards the N terminal of human ELOVL5. Synthetic peptide located within the following region: EHFDASLSTYFKALLGPRDTRVKGWFLLDNYIPTFICSVIYLLIVWLGPK
acyl CoA Thioesterase 2 (ACOT2) Rabbit Polyclonal Antibody
TA322465

USD 380.00

In Stock

Anti-ACOT2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 169-468 amino acids of human acyl-CoA thioesterase 2
TA322465 is a possible alternative to TA322466.
FADS2 (N-term) Rabbit Polyclonal Antibody
AP51507PU-N

USD 580.00

2 Weeks

FADS2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 79-108 amino acids from the N-terminal region of Human FADS2
BAAT Rabbit Polyclonal Antibody
TA349701

USD 380.00

In Stock

Rabbit Polyclonal Anti-BAAT Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BAAT