Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: APRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKR

Rabbit polyclonal SMAD6 Antibody (Center)

Applications FC, WB
Reactivities Human (Predicted: Mouse)
Conjugation Unconjugated
Immunogen This SMAD6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 358-386 amino acids from the Central region of human SMAD6.

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE

Rabbit Polyclonal Anti-SMAD6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMAD6 antibody is: synthetic peptide directed towards the N-terminal region of Human SMAD6. Synthetic peptide located within the following region: RRLWRSRVVPDREEGGSGGGGGGDEDGSLGSRAEPAPRAREGGGCGRSEV