SMAD6 Rabbit Polyclonal Antibody

CAT#: TA330050

Rabbit Polyclonal Anti-SMAD6 Antibody

Product Images

WB Suggested Anti-SMAD6 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysateThere is BioGPS gene expression data showing that SMAD6 is expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMAD6 antibody: synthetic peptide directed towards the N terminal of human SMAD6. Synthetic peptide located within the following region: GAPRDASDPLAGAALEPAGGGRSREARSRLLLLEQELKTVTYSLLKRLKE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 53 kDa
• Gene Name: SMAD family member 6
• Database Link:
  NP_005576
  Entrez Gene 4091 Human
  UniProt ID O43541
• Background: SMAD6 (mothers against decapentaplegic homolog 6) is an antagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit selectively BMP (bone morphogenetic proteins) signaling by competing with the co-SMAD SMAD4 for receptor-activated SMAD1. SMAD6 is an inhibitory SMAD (I-SMAD) or antagonistic SMAD.
• Synonyms: AOVD2; HsT17432; MADH6; MADH7
• Note: Immunogen sequence homology: Human: 100%; Dog: 91%; Bovine: 85%; Pig: 85%

Reference Data

• Protein Families: Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
• Protein Pathways: TGF-beta signaling pathway