Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Pig, Rat, Xenopus, Bovine, X. tropicalis)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 199 and 406 of BHMT (Uniprot ID#Q93088)

Rabbit Polyclonal antibody to BHMT (betaine-homocysteine methyltransferase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 243 of BHMT (Uniprot ID#Q93088)

Goat Polyclonal Antibody against BHMT

Applications WB
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-EQQLKELFEKQK, from the C Terminus of the protein sequence according to NP_001704.1.

Rabbit anti-BHMT Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BHMT