Primary Antibodies

Jump to Filters
Download
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
TA503737

USD 478.00

4 Weeks

LPAR1 (EDG2) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
EDG2 (LPAR1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]
CF503737

USD 600.00

3 Weeks

Carrier-free (BSA/glycerol-free) LPAR1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GRPR Rabbit Polyclonal Antibody
TA316872

USD 515.00

2 Weeks

GRPR Rabbit Polyclonal (Extracellular Domain) Antibody

Applications IHC
Reactivities Bat, Dog, Gorilla, Human, Monkey, Pig, Rabbit, Gibbon, Horse (Predicted: Bovine)
Conjugation Unconjugated
Immunogen GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%).
Angiotensin II Type 1 Receptor (AGTR1) Rabbit Polyclonal Antibody
TA328665

USD 850.00

2 Weeks

Rabbit Polyclonal Anti-Angiotensin II Receptor Type-1 (extracellular)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide NSSTEDGIKRIQDDC, corresponding to amino acid residues 4-18 of human AT1 receptor. Extracellular, N-terminus.
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody [Clone ID: OTI1G9]
CF806473

USD 600.00

3 Days

Carrier-free (BSA/glycerol-free) GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
NPY1R Rabbit Polyclonal Antibody
TA321232

USD 380.00

4 Weeks

Anti-NPY1R rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 370-384 amino acids of Human neuropeptide Y receptor Y1
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G9]
TA806473AM

USD 509.00

2 Weeks

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
GABA A Receptor alpha 5 (GABRA5) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G9]
TA806473BM

USD 509.00

2 Weeks

GABRA5 mouse monoclonal antibody, clone OTI1G9 (formerly 1G9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
Dopamine Receptor D4 (DRD4) Rabbit Polyclonal Antibody
TA321201

USD 380.00

2 Weeks

Anti-DRD4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-15 amino acids of Human Dopamine receptor D4
VR1 (TRPV1) Rabbit Polyclonal Antibody
TA336871

USD 550.00

Backordered

Rabbit Polyclonal Vanilloid R1/TRPV1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal portion of the rat TRPV1 protein (between residues 1-50) [UniProt O35433]
GABA A Receptor alpha 5 (GABRA5) Rabbit Polyclonal Antibody
TA338505

USD 539.00

5 Days

Rabbit Polyclonal Anti-GABRA5 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRA5 antibody: synthetic peptide directed towards the middle region of human GABRA5. Synthetic peptide located within the following region: GTSNTTSVSVKPSEEKTSESKKTYNSISKIDKMSRIVFPVLFGTFNLVYW
EDG1 (S1PR1) Rabbit Polyclonal Antibody
TA306649

USD 570.00

2 Weeks

Rabbit Polyclonal S1P1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen S1P1 antibody was raised against a 14 amino acid synthetic peptide near the carboxy terminus of the human S1P1. The immunogen is located within the last 50 amino acids of S1P1.