Primary Antibodies

Jump to Filters
View as table Download
RAD54 (RAD54L) (C-term) Rabbit Polyclonal Antibody
AP53565PU-N

USD 580.00

2 Weeks

RAD54 (RAD54L) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 641-671 amino acids from the C-terminal region of Human RAD54
RAD54 (RAD54L) Rabbit Polyclonal Antibody
TA314749

USD 380.00

In Stock

Rabbit polyclonal anti-RAD54 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD54.
RAD54 (RAD54L) Rabbit Polyclonal Antibody
TA341561

USD 539.00

5 Days

Rabbit Polyclonal Anti-RAD54L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54L antibody: synthetic peptide directed towards the N terminal of human RAD54L. Synthetic peptide located within the following region: VVSPSSLVKNWYNEVGKWLGGRIQPLAIDGGSKDEIDQKLEGFMNQRGAR