Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against RAD9
| Applications | ICC/IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of full length human Rad9 protein |
Goat Polyclonal Antibody against RAD9A
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGPSPVLAEDSEGE, from the C Terminus of the protein sequence according to NP_004575.1. |
Rabbit Polyclonal Anti-RAD9A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAD9A antibody: synthetic peptide directed towards the C terminal of human RAD9A. Synthetic peptide located within the following region: SLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS |
Active filters
Target Symbol
- RAD9
Isotypes
- IgG
Families
- Stem cell - Pluripotency