Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 57 and 246 of Proteasome 20S alpha 6 |
Rabbit Polyclonal antibody to PSME3 (proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse (Predicted: Pig) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 254 of PSME3 |
Rabbit polyclonal antibody to 20S Proteasome alpha3 (proteasome (prosome, macropain) subunit, alpha type, 3)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 137 of Proteasome 20S alpha 3 |
Rabbit Polyclonal antibody to Proteasome 20S alpha 6 (proteasome (prosome, macropain) subunit, alpha type, 6)
| Applications | IF, WB |
| Reactivities | Human, Mouse (Predicted: Rat, Sheep, Chimpanzee, Bovine, Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 6 (Uniprot ID#P60900) |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSMD11 Antibody: synthetic peptide directed towards the C terminal of human PSMD11. Synthetic peptide located within the following region: ALRYAGRQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAK |
Rabbit Polyclonal Anti-PSMA3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMA3 antibody: synthetic peptide directed towards the middle region of human PSMA3. Synthetic peptide located within the following region: VKDKAFELELSWVGELTNGRHEIVPKDIREEAEKYAKESLKEEDESDDDN |
Rabbit Polyclonal Anti-PSME3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PSME3 antibody is: synthetic peptide directed towards the N-terminal region of Human PSME3. Synthetic peptide located within the following region: PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PSMD11 |
Rabbit Polyclonal Anti-PSME3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSME3 antibody: synthetic peptide directed towards the C terminal of human PSME3. Synthetic peptide located within the following region: TVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY |
Rabbit polyclonal anti-PSMD11 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PSMD11. |
PSME3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSME3 |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11. Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI |
Rabbit Polyclonal Anti-PSMD11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSMD11 antibody: synthetic peptide directed towards the N terminal of human PSMD11. Synthetic peptide located within the following region: MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQVKEQSI |
Germany
Japan
United Kingdom
China
