Primary Antibodies

View as table Download

Rabbit Polyclonal Factor VIII Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Factor VIII.

Rabbit Polyclonal Anti-F8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F8 antibody: synthetic peptide directed towards the C terminal of human F8. Synthetic peptide located within the following region: IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ

Factor VIII Sheep Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen F8 / FVIII / Factor VIII antibody was raised against human Factor VIIIC (F. VIII) purified from F. VIII concentrate.

Rabbit anti Coagulation Factor VIII (Fused form) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to fused portion of human FVIII protein surrounding to HQREI domain with depletion of cleavage terminus.

Rabbit anti Coagulation Factor VIII (Cleaved form, N-term) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to N-term of the cleavage form VLLKRHHQR of human FVIII protein. It also identical to mouse, chicken origin.

Rabbit anti Coagulation Factor VIII (Cleaved form, C-Term) Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to C-term of the cleavage form around sequence EITRTTLQS of human FVIII protein. It also identical to mouse, chicken origin.