Primary Antibodies

View as table Download

METAP2 (Methionine Aminopeptidase 2) mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) METAP2 mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

METAP2 mouse monoclonal antibody,clone 1F6, Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

METAP2 mouse monoclonal antibody,clone 1F6, HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

METAP2 (Methionine Aminopeptidase 2) mouse monoclonal antibody, clone OTI1F6 (formerly 1F6)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-METAP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METAP2 antibody: synthetic peptide directed towards the N terminal of human METAP2. Synthetic peptide located within the following region: ATGKKKKKKKKKRGPKVQTDPPSVPICDLYPNGVFPKGQECEYPPTQDGR