Rabbit polyclonal antibody to PSMB8 (proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7))
| Applications | IF, IHC, WB |
| Reactivities | Human (Predicted: Rat, Dog, Pig, Xenopus, Zebrafish, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 52 and 276 of PSMB8 (Uniprot ID#P28062) |
Rabbit Polyclonal Anti-UCHL3 Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL3 antibody: synthetic peptide directed towards the N terminal of human UCHL3. Synthetic peptide located within the following region: MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC |
PSMB5 goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Bovine, Bat, Canine, Equine, Hamster, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | PSMB5 antibody was raised against synthetic peptide from human PSMB5 / MB1 |
Rabbit Polyclonal Anti-UCHL5 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCHL5 antibody: synthetic peptide directed towards the middle region of human UCHL5. Synthetic peptide located within the following region: DGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRK |
Rabbit polyclonal anti-ATG4B antibody (Center)
| Applications | WB |
| Reactivities | Human (Predicted: Mouse, Zebrafish, Bovine, Chicken) |
| Conjugation | Unconjugated |
| Immunogen | This ATG4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-290 amino acids from the Central region of human ATG4B. |
BAP1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Zebrafish |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
