KCNJ3 (GIRK1 ) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
KCNJ3 (GIRK1 ) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KCNJ3 mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNK13 Antibody
Applications | IHC, WB |
Reactivities | Human, Dog |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KCNK13 antibody: synthetic peptide directed towards the C terminal of human KCNK13. Synthetic peptide located within the following region: GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA |
USD 509.00
2 Weeks
KCNJ3 (GIRK1 ) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), Biotinylated
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Biotin |
USD 509.00
2 Weeks
KCNJ3 (GIRK1 ) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5), HRP conjugated
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | HRP |
Goat Polyclonal Antibody against Kcnj11 (Near N-terminal)
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence ERRARFVSKKGNC, from the internal region (near the N Terminus) of the protein sequence according to NP_034732.1. |
KCNMA1 / BK Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Chicken, Dog, Xenopus, Human, Monkey, Mouse, Pig, Rabbit, Rat, Zebrafish, Hamster |
Conjugation | Unconjugated |
Immunogen | KCNMA1 / BK antibody was raised against synthetic 15 amino acid peptide from internal region of human KCNMA1. Percent identity with other species by BLAST analysis: Human, Monkey, Mouse, Rat, Hamster, Bovine, Dog, Rabbit, Pig, Turkey, Chicken, Xenopus, Seabass, Stickleback, Pufferfish, Zebrafish (100%). |
KCNH2 / HERG Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bovine, Dog, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse (Predicted: Bat, Guinea Pig) |
Conjugation | Unconjugated |
Immunogen | KCNH2 / HERG antibody was raised against synthetic 16 amino acid peptide from internal region of human KCNH2 / Kv11.1. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Horse, Rabbit, Pig (100%); Bat, Guinea pig (94%). |
Goat Anti-KCNQ1 Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-EQLTVPRRGPDEGS, from the C-Terminus of the protein sequence according to NP_000209.2; NP_861463.1. |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan, Guinea Pig (Predicted: Bat) |
Conjugation | Unconjugated |
Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (100%); Panda, Bat (94%); Opossum (89%). |
KCNJ6 / GIRK2 Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Bat, Bovine, Dog, Gorilla, Human, Monkey, Mouse, Pig, Rat, Gibbon, Hamster, Horse, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | KCNJ6 / GIRK2 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human KCNJ6 / GIRK2. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bovine, Bat, Horse, Pig (100%); Opossum (93%); Turkey, Platypus, Lizard (87%). |
Rabbit Polyclonal Anti-KCNN4 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human (Predicted: Monkey, Dog, Pig, Rabbit) |
Conjugation | Unconjugated |
Immunogen | KCNN4 / KCa3.1 antibody was raised against synthetic 14 amino acid peptide from N-Terminus of human KCNN4. Percent identity with other species by BLAST analysis: Human, Gorilla, Bovine (100%); Marmoset, Panda, Dog, Rabbit, Pig (93%); Mouse, Rat, Guinea pig (86%). |
KCNJ3 (GIRK1 ) mouse monoclonal antibody, clone OTI1C5 (formerly 1C5)
Applications | IF, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".