Primary Antibodies

View as table Download

Rabbit polyclonal antibody to PPA1 (pyrophosphatase (inorganic) 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 289 of PPA1 (Uniprot ID#Q15181)

PPA1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPA1

Rabbit Polyclonal Anti-PPA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPA1 antibody: synthetic peptide directed towards the N terminal of human PPA1. Synthetic peptide located within the following region: PRWSNAKMEIATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQT