Primary Antibodies

Jump to Filters
View as table Download
SH3BP2 Rabbit Polyclonal Antibody
TA342205

USD 539.00

5 Days

Rabbit polyclonal Anti-SH3BP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SH3BP2 antibody: synthetic peptide directed towards the middle region of human SH3BP2. Synthetic peptide located within the following region: RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ
SH3BP2 (Center) Rabbit Polyclonal Antibody
AP53901PU-N

USD 580.00

2 Weeks

SH3BP2 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 150-180 amino acids from the Central region of Human SH3BP2