Germany
Japan
United Kingdom
China
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Primary Antibodies
View as table Download
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (glycerol/BSA-free) GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
Anti-GRK4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 36-145 amino acids of human G protein-coupled receptor kinase 4 |
TA323501 is a possible alternative to TA323502.
Rabbit Polyclonal Anti-GRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: QSRFVVSLAYAYETKDALCLVLTIMNGGDLKFHIYNLGNPGFDEQRAVFY |
Rabbit Polyclonal Anti-GRK4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GRK4 Antibody: synthetic peptide directed towards the middle region of human GRK4. Synthetic peptide located within the following region: EKVKWEEVDQRIKNDTEEYSEKFSEDAKSICRMLLTKNPSKRLGCRGEGA |
GRK4 mouse monoclonal antibody, clone OTI4F5 (formerly 4F5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
GRK4 mouse monoclonal antibody, clone OTI9A3 (formerly 9A3)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Active filters
Target Symbol
- GRK4
Families
- Druggable Genome
Pathways
- Endocytosis