Primary Antibodies

View as table Download

Rabbit polyclonal EXT2 Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human (Predicted: Mouse, Bovine)
Conjugation Unconjugated
Immunogen This EXT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-209 amino acids from the Central region of human EXT2.

EXT1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EXT1

Rabbit Polyclonal Anti-HS3ST1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HS3ST1 Antibody: synthetic peptide directed towards the middle region of human HS3ST1. Synthetic peptide located within the following region: TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV

Rabbit Polyclonal Anti-EXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EXT2 antibody: synthetic peptide directed towards the N terminal of human EXT2. Synthetic peptide located within the following region: NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW

HS3ST1 Goat Polyclonal Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Cow)
Conjugation Unconjugated
Immunogen C Terminus (NKLHEYFHEPNKK)