Primary Antibodies

Jump to Filters
View as table Download
PI4KB (Center) Rabbit Polyclonal Antibody
AP17647PU-N

USD 580.00

2 Weeks

PI4KB (Center) rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Bovine, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 519-548 amino acids from the Center region of Human PIK4CB.
PI4KB Rabbit Polyclonal Antibody
TA337683

USD 539.00

5 Days

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the N terminal of human PI4KB. Synthetic peptide located within the following region: LILSDELKPAHRKRELPSLSPAPDTGLSPSKRTHQRSKSDATASISLSSN
PI4KB Rabbit Polyclonal Antibody
TA337684

USD 539.00

5 Days

Rabbit Polyclonal Anti-PI4KB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PI4KB antibody: synthetic peptide directed towards the middle region of human PI4KB. Synthetic peptide located within the following region: HMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQM