VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-VPS28 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
Applications | IF, IHC, WB |
Reactivities | Human, Dog, Rat, Monkey, Mouse |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Goat Polyclonal Antibody against VPS28
Applications | IHC, WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ESAYNAFNRFLHA, from the C Terminus of the protein sequence according to NP_057292.1. |
Rabbit Polyclonal Anti-VPS28 Antibody - N-terminal region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-VPS28 antibody: synthetic peptide directed towards the N terminal of human VPS28. Synthetic peptide located within the following region: MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ |