Primary Antibodies

View as table Download

CYP17A1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP17A1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYP17A1 mouse monoclonal antibody, clone OTI3F11 (formerly 3F11)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-CYP11A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP11A1 antibody: synthetic peptide directed towards the middle region of human CYP11A1. Synthetic peptide located within the following region: LRQKGSVHHDYRGILYRLLGDSKMSFEDIKANVTEMLAGGVDTTSMTLQW

CYP21A2 mouse monoclonal antibody,clone OTI7B6

Applications WB
Reactivities Human
Conjugation Unconjugated

CYP21A2 mouse monoclonal antibody,clone OTI3D1

Applications WB
Reactivities Human
Conjugation Unconjugated

CYP21A2 mouse monoclonal antibody,clone OTI2E4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP17A1 mouse monoclonal antibody, clone OTI3F12 (formerly 3F12)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP17A1 mouse monoclonal antibody, clone OTI9H4 (formerly 9H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP17A1 mouse monoclonal antibody, clone OTI5G10 (formerly 5G10)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYP17A1 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)

Applications WB
Reactivities Human
Conjugation Unconjugated