Primary Antibodies

View as table Download

Goat Anti-TAF7L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NHFQSVLEQLELQEK, from the internal region (near C Terminus) of the protein sequence according to NP_079161.2.

Rabbit Polyclonal Anti-TAF7L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF7L Antibody: synthetic peptide directed towards the middle region of human TAF7L. Synthetic peptide located within the following region: QKQIEKKEKKLHKIQNKAQRQKDLIMKVENLTLKNHFQSVLEQLELQEKQ

TAF7L Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated