Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-CACNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CACNB3 antibody is: synthetic peptide directed towards the C-terminal region of Human CACNB3. Synthetic peptide located within the following region: QDLYQPHRQHTSGLPSANGHDPQDRLLAQDSEHNHSDRNWQRNRPWPKDS

Rabbit Polyclonal Anti-CACNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the C terminal of human CACNB3. Synthetic peptide located within the following region: EHSPLERDSLMPSDEASESSRQAWTGSSQRSSRHLEEDYADAYQDLYQPH

Rabbit Polyclonal Anti-CACNB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CACNB3 antibody: synthetic peptide directed towards the n terminal of human CACNB3. Synthetic peptide located within the following region: MYDDSYVPGFEDSEAGSADSYTSRPSLDSDVSLEEDRESARREVESQAQQ