Rabbit Polyclonal Anti-H2AFY Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the N terminal of human H2AFY. Synthetic peptide located within the following region: HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV |
Rabbit Polyclonal Anti-H2AFY Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the middle region of human H2AFY. Synthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG |
Rabbit Polyclonal Anti-H2AFY Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the N terminal of human H2AFY. Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA |
Germany
Japan
United Kingdom
China
