MACROH2A1 Rabbit Polyclonal Antibody

CAT#: TA344391

Rabbit Polyclonal Anti-H2AFY Antibody - N-terminal region

Product Images

WB Suggested Anti-H2AFY Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: NCI-H226 cell lysateH2AFY is strongly supported by BioGPS gene expression data to be expressed in NCI-H226

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-H2AFY antibody: synthetic peptide directed towards the N terminal of human H2AFY. Synthetic peptide located within the following region: MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 41 kDa
• Gene Name: H2A histone family member Y
• Database Link:
  NP_613075
  Entrez Gene 9555 Human
  UniProt ID O75367
• Background: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core hi
• Synonyms: H2A; H2A.y; H2AF12M; MACROH2A1.1; macroH2A1.2; mH2A1; y
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Pathways: Systemic lupus erythematosus