TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
Carrier-free (BSA/glycerol-free) TYR mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-TYR Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-319 amino acids of human tyrosinase |
Rabbit Polyclonal Anti-DBH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DBH |
Tyrosinase (TYR) (C-term) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 486-513 amino acids from the C-terminal region of Human Tyrosinase. |
Dopamine beta Hydroxylase (DBH) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 27-56 amino acids from the N-terminal region of Human DBH. |
TYR (Tyrosinase) mouse monoclonal antibody,clone UMAB257
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-DCT Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 222-472 amino acids of human dopachrome tautomerase |
Rabbit anti-MAOB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MAOB |
Rabbit Polyclonal Anti-TYRP1 Antibody
Applications | IHC, WB |
Reactivities | Mouse, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP |
Rabbit polyclonal anti-DCT (dopachrome tautomerase) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DCT. |
Rabbit polyclonal AOC3 Antibody (Center)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3. |