Germany
Japan
United Kingdom
China
OR4F17 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | KLH conjugated synthetic peptide between 60-90 amino acids from the N-terminal region of Human Olfactory receptor 4F17 |
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-OR51E2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR51E2 antibody is: synthetic peptide directed towards the C-terminal region of Human OR51E2. Synthetic peptide located within the following region: VRVVMGDIYLLLPPVINPIIYGAKTKQIRTRVLAMFKISCDKDLQAVGGK |
Rabbit Polyclonal Anti-OR51E2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human (Predicted: Mouse, Rat, Bovine) |
| Conjugation | Unconjugated |
| Immunogen | OR51E2 / PSGR antibody was raised against synthetic 14 amino acid peptide from N-terminal extracellular domain of human OR51E2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Galago, Marmoset, Hamster, Bat, Rabbit, Pig (100%); Mouse, Rat, Elephant, Panda, Bovine (93%); Horse (86%). |
Rabbit polyclonal anti-OR10H1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human OR10H1. |
Rabbit Polyclonal anti-OR13C9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
Rabbit Polyclonal anti-OR13C9 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OR13C9 antibody: synthetic peptide directed towards the middle region of human OR13C9. Synthetic peptide located within the following region: IFYGTILFMYMKPKSKETLNSDDLDATDKIISMFYGVMTPMMNPLIYSLR |
Active filters
Conjugates
- Unconjugated
Families
- Transmembrane
Pathways
- Olfactory transduction
Filter by
Category
Target Symbol
- GPR 164 (5)
- OR10J5 (5)
- OR2M2 (5)
- OR10G9 (4)
- OR13C5 (4)
- OR2J2 (4)
- OR52A1 (4)
- OLFACTORY RECEPTOR 10X1 (3)
- OR10A2 (3)
- OR10A6 (3)
- OR10G2 (3)
- OR10H4 (3)
- OR10S1 (3)
- OR1D2 (3)
- OR2AT4 (3)
- OR2F2 (3)
- OR2H3 (3)
- OR2W3 (3)
- OR4A15 (3)
- OR4A47 (3)
- OR4K14 (3)
- OR4L1 (3)
- OR51S1 (3)
- OR52A5 (3)
- OR52D1 (3)
- OR52E2 (3)
- OR5B12 (3)
- OR5I1 (3)
- OR5P3 (3)
- OR5V1 (3)
- OR6K2 (3)
- OR6Q1 (3)
- OR8B4 (3)
- OR8D1 (3)
- OR9G1 (3)
- OR9Q1 (3)
- CLCA4 (2)
- CNG3 (2)
- CNGA4 (2)
- OLFACTORY RECEPTOR OR2A4 (2)
- OR10A4 (2)
- OR10AD1 (2)
- OR10AG1 (2)
- OR10C1 (2)
- OR10H1 (2)
- OR10H5 (2)
- OR10J1 (2)
- OR10J3 (2)
- OR10P1 (2)
- OR10R2 (2)
- OR10V1 (2)
- OR10Z1 (2)
- OR11A1 (2)
- OR12D3 (2)
- OR13C9 (2)
- OR13G1 (2)
- OR13J1 (2)
- OR14J1 (2)
- OR1A1 (2)
- OR1A2 (2)
- OR1D5 (2)
- OR1J4 (2)
- OR1S1 (2)
- OR2A1 (2)
- OR2A7 (2)
- OR2AG1 (2)
- OR2AK2 (2)
- OR2B11 (2)
- OR2B2 (2)
- OR2C1 (2)
- OR2G2 (2)
- OR2G6 (2)
- OR2H1 (2)
- OR2M3 (2)
- OR2M7 (2)
- OR2T1 (2)
- OR2T11 (2)
- OR2T12 (2)
- OR2T2 (2)
- OR2W1 (2)
- OR2Z1 (2)
- OR3A1 (2)
- OR3A2 (2)
- OR4A16 (2)
- OR4C12 (2)
- OR4C6 (2)
- OR4D6 (2)
- OR4F4 (2)
- OR4K2 (2)
- OR4M1 (2)
- OR4N2 (2)
- OR4P4 (2)
- OR4Q3 (2)
- OR51A2 (2)
- OR51A7 (2)
- OR51B2 (2)
- OR51B5 (2)
- OR51B6 (2)
- OR51I2 (2)
- OR51V1 (2)