Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: GPGIGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTPTLGF

Goat Polyclonal Antibody against RXRA

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat)
Conjugation Unconjugated
Immunogen Peptide with sequence CQVNSSLTSPTGRGSM, from the internal region of the protein sequence according to NP_002948.1.

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RXRA Antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI

Rabbit Polyclonal Anti-RXRA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRA antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ