Goat Polyclonal Antibody against SETMAR
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence RWQKCVDCNGSYFD, from the C Terminus of the protein sequence according to NP_006506. |
Rabbit polyclonal anti-SETMAR antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SETMAR. |
Rabbit anti-WHSC1L1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human WHSC1L1 |
Rabbit Polyclonal Anti-WHSC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-WHSC1 Antibody: synthetic peptide directed towards the N terminal of human WHSC1. Synthetic peptide located within the following region: KYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFG |
Rabbit Polyclonal Anti-Wipf1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Wipf1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Wipf1. Synthetic peptide located within the following region: MPVPPPPAPPPPPTFALANTEKPSLNKTEQAGRNALLSDISKGKKLKKTV |
Germany
Japan
United Kingdom
China