Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
NAGA mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI7F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI8H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 380.00
2 Weeks
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI6F3
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI7F1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NAGA mouse monoclonal antibody,clone OTI8H7
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NAGA mouse monoclonal antibody,clone OTI3A4
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-HEXA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV |
Rabbit Polyclonal Anti-GLA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GLA Antibody: synthetic peptide directed towards the N terminal of human GLA. Synthetic peptide located within the following region: PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF |
Active filters
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Glycosphingolipid biosynthesis - globo series