Primary Antibodies

Jump to Filters
View as table Download
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 380.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
Casein Kinase 1 delta (CSNK1D) Rabbit Polyclonal Antibody
TA349833

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-CSNK1D Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1D
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA312479

USD 380.00

In Stock

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.
NR1D1 Rabbit Polyclonal Antibody
TA350237

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NR1D1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NR1D1
CLOCK Rabbit Polyclonal Antibody
TA312928

USD 380.00

In Stock

Rabbit polyclonal anti-Clock antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human Clock.
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA329741

USD 485.00

5 Days

Rabbit Polyclonal Anti-ARNTL Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
Casein Kinase 1 delta (CSNK1D) Goat Polyclonal Antibody
TA302441

USD 520.00

In Stock

Goat Polyclonal Antibody against Casein Kinase 1, delta

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1.
BMAL1 (ARNTL) Rabbit Polyclonal Antibody
TA349717

USD 380.00

In Stock

Rabbit Polyclonal Anti-ARNTL Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ARNTL
CK1 epsilon (CSNK1E) Goat Polyclonal Antibody
TA302458

USD 520.00

5 Days

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog)
Conjugation Unconjugated
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.
BMAL1 (ARNTL) Goat Polyclonal Antibody
TA305628

USD 520.00

5 Days

Goat Anti-BMAL1 / ARNTL Antibody

Applications WB
Reactivities Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow)
Conjugation Unconjugated
Immunogen Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1.
CLOCK Rabbit Polyclonal Antibody
TA310045

USD 360.00

3 Weeks

Rabbit anti-CLOCK polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH
Cryptochrome I (CRY1) Rabbit Polyclonal Antibody
TA313696

USD 380.00

4 Weeks

Rabbit polyclonal anti-CRY1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human CRY1.
CLOCK Rabbit Polyclonal Antibody
TA347532

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Clock Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock