Rabbit Polyclonal Anti-CSNK1E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK1E |
Rabbit Polyclonal Anti-CSNK1E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK1E |
Rabbit Polyclonal Anti-CSNK1D Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK1D |
Rabbit polyclonal anti-CKI-e antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKI-e. |
Rabbit Polyclonal Anti-NR1D1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NR1D1 |
Rabbit polyclonal anti-Clock antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human Clock. |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ARNTL antibody: synthetic peptide directed towards the N terminal of human ARNTL. Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF |
Goat Polyclonal Antibody against Casein Kinase 1, delta
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DREERLRHSRNPATR, from the internal region of the protein sequence according to NP_001884.2; NP_620693.1. |
Rabbit Polyclonal Anti-ARNTL Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ARNTL |
Goat Polyclonal Antibody against CSNK1E
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1. |
Goat Anti-BMAL1 / ARNTL Antibody
Applications | WB |
Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence REKITTNCYKFKIKD, from the internal region of the protein sequence according to NP_001169.3; NP_001025444.1. |
Rabbit anti-CLOCK polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-CRY1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CRY1. |
Rabbit Polyclonal Anti-Clock Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Clock Antibody: A synthesized peptide derived from human Clock |