Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region (NM_014501). |
Rabbit Polyclonal Anti-UBE2S Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2S |
UBE2S rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UBE2S |
Rabbit Polyclonal Antibody against UBE2S (C-term)
Applications | IHC, WB |
Reactivities | Human (Predicted: Bovine, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 192-222 amino acids from the C-terminal region of human E2EPF. |
Rabbit Polyclonal Antibody against UBE2S (N-term)
Applications | IHC, WB |
Reactivities | Human (Predicted: Mouse, Rat, Bovine, Xenopus) |
Conjugation | Unconjugated |
Immunogen | This E2EPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-40 amino acids from the N-terminal region of human E2EPF. |
Rabbit Polyclonal Anti-UBE2S Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UBE2S antibody: synthetic peptide directed towards the N terminal of human UBE2S. Synthetic peptide located within the following region: NSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPE |
UBE2S Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse UBE2S |