Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Prostatic Acid Phosphatase (ACPP) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IHC, IP, R, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acid Phosphatase isolated and purified from Human seminal plasma. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Rabbit Polyclonal Anti-ACP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ACP1 antibody: synthetic peptide directed towards the N terminal of human ACP1. Synthetic peptide located within the following region: PIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIP |
CD203c Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Dog, Human, Monkey, Gibbon, Orang-Utan (Predicted: Bovine, Horse, Pig) |
| Conjugation | Unconjugated |
| Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%). |
CD203c Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Gibbon (Predicted: Monkey) |
| Conjugation | Unconjugated |
| Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Pathways
- Riboflavin metabolism