Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Anti-NTRK3
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTRK3 antibody: synthetic peptide directed towards the C terminal of human NTRK3. Synthetic peptide located within the following region: ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG |
Goat Polyclonal Anti-BDNF Antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1. |
Rabbit polyclonal Trk B (Tyr515) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk B around the phosphorylation site of tyrosine 515 (P-Q-YP-F-G). |
| Modifications | Phospho-specific |
Rabbit Polyclonal NGFR Antibody
| Applications | ELISA, ICC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | NGFR antibody was raised against purified recombinant human NGFR. |
Rabbit Polyclonal Trk B (Tyr515) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Trk B around the phosphorylation site of Tyrosine 515 (peptide seq 509-521aa: VIENPQY(p)FGITN) |
| Modifications | Phospho-specific |
Active filters
Clonalities
- Polyclonal
Families
- Transmembrane
Pathways
- Neurotrophin signaling pathway