Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal anti-HDAC-1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1. |
Rabbit Polyclonal anti-STAT6 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM |
DLL4 rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the internal region of human DLL4. |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Active filters
Isotypes
- IgG
Clonalities
- Polyclonal
Families
- Stem cell relevant signaling - DSL/Notch pathway
Filter by
Category
Target Symbol
Reactivities
Applications
Antibody Hosts
Conjugates
Modifications
Assay Types
Pathways
- Pathways in cancer (51)
- Jak-STAT signaling pathway (40)
- Chronic myeloid leukemia (36)
- Cell cycle (32)
- Notch signaling pathway (31)
- Acute myeloid leukemia (23)
- Prostate cancer (19)
- Small cell lung cancer (19)
- p53 signaling pathway (19)
- ECM-receptor interaction (14)
- Hematopoietic cell lineage (14)
- ErbB signaling pathway (13)
- Huntington's disease (13)
- Bladder cancer (10)
- Colorectal cancer (10)
- Endometrial cancer (10)
- Focal adhesion (10)
- Glioma (10)
- Melanoma (10)
- Non-small cell lung cancer (10)
- Pancreatic cancer (10)
- Thyroid cancer (10)
- Viral myocarditis (10)
- Wnt signaling pathway (10)
- Dorso-ventral axis formation (9)
- Oocyte meiosis (9)
- Prion diseases (9)
- Basal cell carcinoma (6)
- Hedgehog signaling pathway (6)
- Cytokine-cytokine receptor interaction (1)