Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Goat Anti-COPS3 Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SLYKKNIQRLT, from the internal region of the protein sequence according to NP_003644.2. |
Rabbit Polyclonal Anti-COPS3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COPS3 antibody is: synthetic peptide directed towards the C-terminal region of Human COPS3. Synthetic peptide located within the following region: HNIDQEMLKCIELDERLKAMDQEITVNPQFVQKSMGSQEDDSGNKPSSYS |
Rabbit Polyclonal Anti-COPS3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cops3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cops3. Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD |
Rabbit Polyclonal Anti-COPS3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COPS3 Antibody: A synthesized peptide derived from human COPS3 |
Active filters
Target Symbol
- COPS3
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency