COPS3 Rabbit Polyclonal Antibody

CAT#: TA342586

Rabbit Polyclonal Anti-COPS3 Antibody

Product Images

Host: Rabbit; Target Name: Cops3; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cops3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cops3. Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 46 kDa
• Gene Name: COP9 signalosome subunit 3
• Database Link:
  NP_003644
  Entrez Gene 287367 Rat
  UniProt ID Q9UNS2
• Background: Cops3 is a subunit of the COP9 signalosome complex; mouse homolog plays a role in early embryonic development.
• Synonyms: CSN3; SGN3
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Stem cell - Pluripotency