Primary Antibodies

View as table Download

Glutathione Peroxidase 3 (GPX3) (102-114) goat polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Canine, Human, Mouse, Rat, Bovine, Bat, Equine, Monkey, Porcine
Conjugation Unconjugated
Immunogen Synthetic peptide from internal region of human GPX3

Rabbit Polyclonal Glutathione Peroxidase 3 Antibody

Applications ICC/IF, IHC, Immunoblotting, WB
Reactivities Human, Primate, Rat
Conjugation Unconjugated
Immunogen Full length human GPX3 protein [Swiss-Prot# P22352] expressed in E. coli.

Rabbit polyclonal antibody to Glutathione peroxidase 7 (glutathione peroxidase 7)

Applications IHC, WB
Reactivities Human (Predicted: Chimpanzee)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 187 of GPX7 (Uniprot ID#Q96SL4)

Rabbit Polyclonal Anti-GPX3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPX3 antibody: synthetic peptide directed towards the N terminal of human GPX3. Synthetic peptide located within the following region: DCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYI

Goat Polyclonal Antibody against GPX7

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CNQFGQQEPDSNK, from the internal region of the protein sequence according to NP_056511.2.